Rechercher dans ce blog

dimanche 11 décembre 2022

Glucka


Danio Glowlight/Danio Glowlight :
Le danio lumineux (Danio choprae) est un petit poisson en banc étroitement apparenté au populaire poisson zèbre Danio rerio. Cela ne doit pas être confondu avec le GloFish [1], une marque déposée de poisson zèbre fluorescent qui semble briller dans l'obscurité sous la lumière ultraviolette. Danio choprae est une espèce de danionine active qui passe la majeure partie de son temps au milieu de l'eau. Cette espèce se nourrit d'insectes tombés dans l'eau, de larves d'insectes aquatiques et d'autres petits animaux. En aquarium, il accepte la plupart des aliments proposés, y compris la plupart des aliments secs. Il a un corps profilé marqué d'une bande longitudinale orange brillante et d'une série de barres verticales bleu-noir sur les flancs. Les nageoires sont bordées de jaune. Ces dernières années, il est devenu assez largement commercialisé comme poisson d'aquarium, mais n'a par ailleurs aucune importance commerciale. Son nom commun dérive de sa similitude avec le tétra glowlight, un characin sud-américain qui n'est que de loin lié à ce poisson. Ils s'entendent bien avec toutes les autres espèces de Danio, à l'exception du Danio géant. Une variante géographique moins fréquemment commercialisée de la région de Putao au nord du Myanmar, connue sous le nom de "danio lueur du nord", est parfois désignée par un nom scientifique fictif "Danio putaoensis". Cette variante est plus grande et a plus de barres verticales et de barbillons plus longs, elle peut faire référence à Danio flagrans.
Rasbora Glowlight/Rasbora Glowlight :
Le rasbora lumineux (Trigonostigma hengeli) est une espèce de poisson cyprinidé du genre Trigonostigma.
Glowmatographie/Glowmatographie :
La glowmatographie est une technique de laboratoire pour la séparation des colorants présents dans les solutions contenues dans les bâtons lumineux. Les composants chimiques de ces solutions peuvent être séparés par chromatographie en composants polaires et non polaires. Développé comme une expérience de classe en laboratoire, il peut être utilisé pour démontrer les concepts chimiques de polarité, de cinétique chimique et de chimiluminescence.
Bougie de préchauffage/bougie de préchauffage :
Une bougie de préchauffage (également orthographiée comme bougie de préchauffage ou bougie de préchauffage) est un dispositif de chauffage utilisé pour aider au démarrage des moteurs diesel. Par temps froid, les moteurs diesel à grande vitesse peuvent être difficiles à démarrer car la masse du bloc-cylindres et de la culasse absorbe la chaleur de compression, empêchant l'allumage. Les moteurs pré-chambres utilisent de petites bougies de préchauffage à l'intérieur des pré-chambres. Les moteurs à injection directe ont ces bougies de préchauffage dans la chambre de combustion. La bougie de préchauffage est une pièce de métal en forme de crayon avec un élément chauffant à l'extrémité. Cet élément chauffant, lorsqu'il est électrifié, chauffe en raison de sa résistance électrique et commence à émettre de la lumière dans le spectre visible, d'où le terme bougie de préchauffage. L'effet visuel est similaire à l'élément chauffant d'un grille-pain. Le motif de pulvérisation de l'injecteur de carburant empiète alors directement sur la pointe chaude de la bougie de préchauffage lors de l'injection de carburant au point mort haut. Cela enflamme le carburant même lorsque le moteur n'est pas suffisamment chaud pour un fonctionnement normal, ce qui réduit le temps de démarrage nécessaire pour démarrer le moteur.
Glowsticks for_Clubbing_Baby_Seals/Glowsticks for Clubbing Baby Seals :
Glowsticks For Clubbing Baby Seals est un album sorti par le groupe d'Orlando Indorphine. Indorphine a également inclus un instrumental pour cet album intitulé « Blue Eskimo ». Le titre bleu est un thème récurrent avec le groupe pour leurs instrumentaux.
Glowtini/Glowtini :
Le Glowtini est un cocktail inspiré de la célébration de l'année du million de rêves à Walt Disney World Resort et de certains emplacements de Disneyland Resort. Le Glowtini est servi dans les restaurants de Disney World. Il se compose de vodka Skyy Citrus, de curaçao bleu, de schnaps à la pêche et de jus aigre-doux et d'ananas. Il est garni d'un cube lumineux souvenir. Les "glaçons" du cube lumineux sont en plastique transparent et comportent des LED qui clignotent et clignotent une fois qu'un bouton est activé. Les gagnants sont sélectionnés par un jury composé d'éminents professionnels des boissons et de membres de l'équipe de Cheers Beverage Conference.
Ver luisant/Ver luisant :
Le ver luisant ou ver luisant est le nom commun de divers groupes de larves d'insectes et de femelles larviformes adultes qui brillent par bioluminescence. Ils comprennent le ver luisant commun européen et d'autres membres des Lampyridae, mais la bioluminescence se produit également dans les familles Elateridae, Phengodidae et Rhagophthalmidae parmi les coléoptères; ainsi que des membres des genres Arachnocampa, Keroplatus et Orfelia parmi les moucherons des champignons kéroplatidés.
Glowworm (astronomie)/Glowworm (astronomie):
Un ver luisant est une traînée lumineuse d'un minuscule météore, parfois visible dans le ciel nocturne lors d'une pluie de météores. Les morceaux de comète de la taille d'un centimètre peuvent produire des centaines de boules de feu ou plus chaque heure. Dans certains cas, en particulier pendant les Léonides, les boules de feu font des traînées lumineuses qui peuvent rester allumées pendant 10 à 15 minutes, selon les astronomes.
Glowworm (homonymie)/Glowworm (homonymie) :
Un ver luisant est le stade de larve incandescente de divers insectes. Glowworm peut également faire référence à: Glo Worm, un jouet pour enfants HMS Glowworm, trois navires de la marine britannique Glowworm (astronomie), la traînée lumineuse d'un minuscule météore Glowworm (bandes dessinées), deux personnages indépendants de Marvel Comics Glowworm Records, une filiale d'Epic Records " The Glow-Worm", une chanson écrite par Paul Lincke Gloworm, un groupe de musique house actif dans les années 1990 "Glow Worm", une chanson de Skrillex "Glowworm", une chanson de The Apples in Stereo sur leur album Fun Trick Noisemaker The Glowworm , un personnage du livre pour enfants James and the Giant Peach Glow-worm, un fabricant britannique de chaudières et l'une des huit marques qui forment le groupe Vaillant.
Tunnel de vers luisants/tunnel de vers luisants :
Le tunnel Glowworm est un tunnel ferroviaire désaffecté entre Lithgow, Nouvelle-Galles du Sud et Newnes, Nouvelle-Galles du Sud, Australie. Il est remarquable pour ses vers luisants résidents, les larves bioluminescentes d'Arachnocampa richardsae, un type de moucheron fongique.
Gloxinelle/Gloxinelle :
Gloxinella est un genre monotypique de plantes à fleurs appartenant à la famille des Gesneriaceae. Il ne contient qu'une seule espèce, Gloxinella lindeniana (Regel) Roalson & Boggan Il est originaire de Colombie. Le nom du genre est en l'honneur de Benjamin Peter Gloxin (1765–1794), médecin et écrivain botanique allemand. L'épithète latine spécifique de lindeniana fait référence au botaniste d'origine luxembourgeoise Jean Jules Linden (1817-1898). Il a été décrit et publié pour la première fois dans Selbyana Vol.25 à la page 227 en 2005.
Gloxinie/Gloxinie :
Gloxinia peut désigner : Gloxinia (genre), plantes à fleurs de la famille des Gesneriaceae Sinningia speciosa, une espèce végétale anciennement classée dans le genre Gloxinia et encore communément connue sous ce nom, dans la famille des Gesneriaceae Gloxinia rampante (Lophospermum erubescens), dans la famille Plantaginaceae, anciennement dans les Scrophulariaceae Hardy gloxinia (Incarvillea delavayi), dans la famille des Bignoniaceae
Gloxinia (genre)/Gloxinia (genre):
Gloxinia est un genre contenant trois espèces d'herbes tropicales à rhizome de la famille des plantes à fleurs Gesneriaceae. L'espèce se trouve principalement dans les Andes d'Amérique du Sud, mais Gloxinia perennis se trouve également en Amérique centrale et aux Antilles, où elle s'est probablement échappée de la culture. Gloxinia perennis est l'espèce originale (type) du genre, et pendant une grande partie de son histoire, le genre ne comprenait que G. perennis et un très petit nombre d'autres espèces. La classification de Gloxinia modifiée plus tard reflète la classification de 1976 de Hans Wiehler, qui a adopté une vision plus large du genre. Une analyse récente de Gloxinia et des genres apparentés basée sur des travaux moléculaires et morphologiques a déterminé que la circonscription de Wiehler du genre n'était pas naturelle, à la fois phylogénétiquement et morphologiquement. Les analyses ont démontré que les genres Anodiscus et Koellikeria, chacun avec une seule espèce, étaient plus étroitement liés à Gloxinia perennis qu'aucune des autres espèces incluses dans Gloxinia par Wiehler, dont plusieurs se sont avérées plus étroitement liées à d'autres genres (en particulier Diastème, Monopyle et Phinée). À la suite de ce travail, la plupart des anciennes espèces de Gloxinia ont été transférées à d'autres genres tandis que Koellikeria erinoides et Anodiscus xanthophyllus ont été transférées dans une Gloxinia beaucoup plus étroitement définie composée de seulement trois espèces, toutes caractérisées par une floraison en forme de grappe. tige. Les anciennes espèces de Gloxinia ont été transférées à un grand nombre d'autres genres, y compris les genres existants Monopyle et Sinningia, les genres ressuscités Mandirola et Seemannia, et les nouveaux genres Gloxinella, Gloxiniopsis, Nomopyle et Sphaerorrhiza. Gloxinia perennis forme des hybrides fertiles avec des espèces de Seemannia , ce qui était la principale raison de l'union des deux genres dans le passé. Sinningia speciosa , une plante d'intérieur populaire, a été initialement décrite et introduite en culture sous le nom de Gloxinia speciosa et est encore parfois appelée «gloxinia» ou «gloxinia du fleuriste», bien que ce nom soit maintenant inexact et techniquement incorrect. De même, « gloxinia rustique » est Incarvillea delavayi, un membre des Bignoniacées.
Gloxinia perennis/Gloxinia perennis :
Gloxinia perennis est une espèce de plante herbacée tropicale à rhizome appartenant à la famille des Gesneriaceae. Il est parfois connu sous le nom de "cloches de Canterbury" (à ne pas confondre avec les membres du genre Campanula, qui portent le même nom).
Gloxiniopsis/Gloxiniopsis :
Gloxiniopsis est un genre de plantes à fleurs appartenant à la famille des Gesneriaceae. Son aire de répartition naturelle est la Colombie. Espèce : Gloxiniopsis racemosa (Benth.) Roalson & Boggan
Gloy-Rahal Racing/Gloy-Rahal Racing :
Gloy-Rahal Racing était une équipe NASCAR détenue conjointement par Bobby Rahal, propriétaire de Team Rahal, et Tom Gloy, propriétaire de Tom Gloy Racing. L'équipe a couru une Ford dans la NASCAR Craftsman Truck Series à temps partiel en 1997 et à temps plein en 1998 et 1999.
Gloydius/Gloydius :
Gloydius est un genre de pitvipers venimeux endémiques d'Asie, également connus sous le nom de mocassins asiatiques ou de vipères terrestres asiatiques. Nommé d'après l'herpétologue américain Howard K. Gloyd, ce genre est très similaire au genre nord-américain Agkistrodon. 24 espèces sont actuellement reconnues.
Gloydius brevicauda/Gloydius brevicauda :
Gloydius brevicauda est une espèce de vipère venimeuse endémique de Chine et de la péninsule coréenne. Noms communs : vipère à queue courte, mamushi à queue courte.
Gloydius halys/Gloydius halys :
Noms communs : vipère sibérienne, vipère Halys, vipère Halys, plus. Cinq sous-espèces sont actuellement reconnues, y compris la forme nominative décrite ici.
Gloydius himalayanus/Gloydius himalayanus :
Gloydius himalayanus également connu sous le nom de vipère de l'Himalaya ou vipère de l'Himalaya est une espèce de vipère venimeuse trouvée le long des pentes sud de l'Himalaya au Pakistan, en Inde et au Népal. Aucune sous-espèce n'est actuellement reconnue. Les vipères de l'Himalaya ont été trouvées jusqu'à 4900 m au-dessus du niveau de la mer, ce qui en fait le serpent vivant le plus haut jamais trouvé.
Gloydius intermédiaire/Gloydius intermédiaire :
Noms communs : vipère d'Asie centrale, mamushi intermédiaire, vipère de fosse mongole, plus.Gloydius intermedius est une espèce de pitviper venimeuse endémique du nord de l'Asie. Trois sous-espèces sont actuellement reconnues, y compris la sous-espèce nominale décrite ici.
Gloydius lateralis/Gloydius lateralis :
Gloydius lateralis est une espèce de vipère venimeuse trouvée dans la vallée de Zharu du comté de Jiuzhaigou, en Chine. L'espèce est active pendant les journées ensoleillées dans les zones chaudes et sèches le long des routes. La vallée de Zharu est le seul emplacement connu de G. lateralis. On suppose que ce serpent mange de petits mammifères comme des souris, d'après les restes de fourrure trouvés dans ses excréments. Cette lignée d'espèces est un taxon frère de G. swild, étant morphologiquement et phylogénétiquement similaire. L'espèce a un petit corps, de grands yeux (par rapport à la tête), des fosses bilatérales et des écailles sous-caudales divisées. L'espèce a également 20 à 21 rangées d'écailles dorsales au milieu du corps. Le corps dorsal est verdâtre à brun clair et avec 4 rangées de taches brun foncé en zigzag. Une bande ventrolatérale continue et régulière gris-brun descend de chaque côté du corps et de la queue. Le nom scientifique "lateralis" vient de cette bande gris-brun que porte G. lateralis.
Gloydius monticola/Gloydius monticola :
Noms communs : vipère de Likiang, vipère de Likiang. Gloydius monticola est une espèce de vipère venimeuse endémique du sud de la Chine. Un petit serpent de couleur sombre sans motif de couleur visible, on le trouve haut dans les montagnes de la province du nord du Yunnan. Aucune sous-espèce n'est actuellement reconnue.
Gloydius saxatilis/Gloydius saxatilis :
Noms communs : vipère de l'Amour, rock mamushi.Gloydius saxatilis est une espèce de vipère venimeuse endémique de Russie, de Chine et de la péninsule coréenne. Aucune sous-espèce n'est actuellement reconnue.
Gloydius shedaoensis/Gloydius shedaoensis :
Noms communs : Pitviper de l'île de Shedao, pit-viper de Shedao. Gloydius shedaoensis est une espèce de pitviper venimeuse que l'on ne trouve que sur l'île de Shedao en Chine. Bien que très petite, cette île abrite une population extraordinairement importante de ces serpents. Aucune sous-espèce n'est actuellement reconnue.
Gloydius strauchi/Gloydius strauchi :
Noms communs : vipère tibétaine, vipère de Strauch.Gloydius strauchi est une espèce de vipère venimeuse de la sous-famille des Crotalinae de la famille des Viperidae. L'espèce est originaire de l'ouest de la Chine. C'est un petit serpent avec un motif de quatre bandes longitudinales, bien que certains spécimens plus anciens puissent être d'un noir uniforme. G. strauchi se distingue de G. monticola par son nombre plus élevé d'écailles dorsales au milieu du corps. Cette espèce détient conjointement le record d'altitude pour les pitvipers avec Crotalus triseriatus du Mexique, tous deux se trouvant même au-dessus de la limite des arbres à plus de 4 000 m (13 000 pieds). Aucune sous-espèce n'a été reconnue comme valide, jusqu'à ce qu'une publication récente (Kai Wang et al., 2019) réévalue les statuts taxonomiques des populations de G. strauchi et décrive les populations du Tibet oriental comme une nouvelle espèce.
Gloydius tsushimaensis/Gloydius tsushimaensis :
Gloydius tsushimaensis, ou pitviper de l'île de Tsushima, est une espèce de serpent venimeux de la famille des Viperidae. L'espèce est endémique de l'île de Tsushima au Japon.
Gloydius ussuriensis/Gloydius ussuriensis :
Gloydius ussuriensis est une espèce de pitvipère venimeuse endémique de l'extrême est de la Russie, du nord-est de la Chine et de la péninsule coréenne. Aucune sous-espèce n'est actuellement reconnue. Noms communs : vipère Ussuri, Ussuri mamushi.
Artefacts Glozel/Artefacts Glozel :
Les artefacts de Glozel sont une collection de plus de 3 000 artefacts, dont des tablettes d'argile, des sculptures et des vases, dont certains étaient inscrits, découverts de 1924 à 1930 à proximité du hameau français de Glozel. Glozel (46°02′N 3°36′E) fait partie de la commune de Ferrières-sur-Sichon dans le département de l'Allier, à environ 17 km de Vichy dans le centre de la France. Diversement datées du néolithique, de l'âge du fer et de l'époque médiévale, les découvertes ont lancé une série de revendications, de demandes reconventionnelles et de débats houleux parmi les archéologues. Les objets ont tous été initialement rejetés comme un canular. Des recherches ultérieures ont confirmé que certains des objets remontaient à l'âge du fer. Après une analyse plus approfondie et une datation, le ministère français de la Culture a publié un rapport en 1995 qui concluait que le site était médiéval et plus tard mais contenait également des artefacts de l'âge du fer. Il a également déclaré que le site comprenait des contrefaçons, auteur inconnu.
Glojène/Glojène :
Glozhene peut faire référence à : Glozhene, province de Lovech, un village de la municipalité de Teteven, Bulgarie Monastère de Glozhene, un monastère près du village de Glozhene, province de Lovech Glozhene Cove, une crique en Antarctique nommée d'après le village de Glozhene, la province de Lovech et le Glozhene Monastère Glozhene, province de Vratsa
Glozhene, Lovech_Province/Glozhene, Lovech Province :
Glozhene (bulgare : Гложене [ˈɡɫɔʒɛnɛ]) est un village de la municipalité de Teteven, dans la province de Lovech, dans le nord de la Bulgarie.
Glozhene, Vratsa_Province/Glozhene, Vratsa Province :
Glozhene (bulgare : Гложене [ˈɡɫɔʒɛnɛ]) est un village du nord-ouest de la Bulgarie. Il est situé dans la municipalité de Kozloduy, Vratsa. Il était auparavant connu sous le nom de Glazhene (Глажене [ˈɡɫaʒɛnɛ]).
Crique de Glozhene/Crique de Glozhene :
Glozhene Cove ( bulgare : залив Гложене , romanisé : zaliv Glozhene , IPA : [ˈzaliv ˈɡɫɔʒɛnɛ] ) est la crique de 700 m de large indentant sur 400 m la côte nord-ouest de l'île Smith , îles Shetland du Sud à l'ouest du cap Smith . Cartographie précoce bulgare en 2009. Nommé d'après la colonie de Glozhene et le monastère homonyme de Glozhene dans le nord de la Bulgarie.
Monastère de Glozhene/Monastère de Glozhene :
Le monastère de Glozhene (bulgare : Гложенски манастир [ˈɡɫɔʒɛnski manɐsˈtir]) est un monastère orthodoxe oriental situé sur le versant nord de Stara Planina en Bulgarie, près du village de Glozhene et de la rivière Cherni Vit, à 12 km de Teteven.
Glo%C5%A1ka planina/Gloška planina :
Gloška planina (en serbe cyrillique : Глошка планина) est une montagne du sud-est de la Serbie, près de la ville de Bosilegrad. Son plus haut sommet Mečit a une altitude de 1756 m (5761 pieds) au-dessus du niveau de la mer.
Glo%C5%BEan/Gložan :
Gložan ( serbe cyrillique : Гложан ) est un village situé dans la municipalité de Bački Petrovac , dans le district sud de Bačka en Serbie . Il est situé dans la province autonome de Voïvodine. La population du village compte 2 283 personnes (recensement de 2002), dont 1 985 sont des Slovaques ethniques.
Glo%C5%BEane/Gložane :
Gložane peut faire référence à : Gložane (Svilajnac), un village de Serbie Gložane (Vlasotince), un village de Serbie
Glo%C5%BEane (Svilajnac)/Gložane (Svilajnac) :
Gložane est un village de la municipalité de Svilajnac, en Serbie. Selon le recensement de 2002, le village a une population de 1017 personnes.
Glo%C5%BEane (Vlasotince)/Gložane (Vlasotince):
Gložane est un village de la municipalité de Vlasotince, en Serbie. Selon le recensement de 2002, le village a une population de 660 personnes.
Glo%C5%BEin/Gložin :
Gložin (cyrillique : Гложин) est un village de la municipalité de Čajniče, en Bosnie-Herzégovine.
Glo%C5%BEje/Gložje :
Gložje (en serbe cyrillique : Гложје) est un village de la municipalité de Bosilegrad, en Serbie.
Glo%C7%B5i/Gloǵi :
Gloǵi ( macédonien : Глоѓи , albanais : Gllogjë ) est un village de la municipalité de Tearce , en Macédoine du Nord .
Motif ARN_GltS/Motif ARN GltS :
Le motif d'ARN gltS est une structure d'ARN conservée qui a été découverte par la bioinformatique. Les motifs gltS se trouvent dans la lignée bactérienne Vibrionaceae. Les ARN du motif gltS fonctionnent probablement comme des éléments cis-régulateurs, compte tenu de leurs positions en amont des gènes codant pour les protéines. Ces gènes vraisemblablement régulés codent pour des sous-unités de la glutamate synthase ou d'une enzyme apparentée (la spécificité exacte de l'enzyme est incertaine). Un ribocommutateur de glutamine a été découvert qui est souvent situé en amont des gènes de la glutamate synthase, mais est également présent en amont d'autres gènes, tels que ceux codant pour la glutamine synthétase et les transporteurs d'ammonium.
Glu/Glu :
Glu ou GLU peut faire référence à : Glu Mobile, un éditeur américain de jeux mobiles Acide glutamique God Lives Underwater, un groupe de rock industriel américain God Lives Underwater (EP) Gula language (Tchad) Guyana Labour Union OpenGL Utility Library, une bibliothèque d'infographie
Glu-Glu dipeptidase/Glu-Glu dipeptidase :
La Glu-Glu dipeptidase (EC 3.4.13.7, alpha-glutamyl-glutamate dipeptidase, glutamylglutamique arylamidase) est une enzyme. Cette enzyme catalyse la réaction chimique suivante Hydrolyse du dipeptide Glu!Glu
Glu3d/Glu3d :
Glu3D est un plugin qui simule des effets fluides dans les programmes de modélisation 3dsmax et Maya3D.
Glu Mobile/Glu Mobile :
Glu Mobile LLC est un développeur et éditeur américain de jeux vidéo pour téléphones mobiles et tablettes. Fondée à San Francisco, en Californie, en 2004, Glu propose des produits sur plusieurs plates-formes, notamment les appareils basés sur Java ME, Android, Windows Phone, Google Chrome et Amazon. Il était auparavant coté au Nasdaq avant d'être acquis par Electronic Arts en avril 2021.
Gluaiseacht/Gluaiseacht :
Gluaiseacht for Global Justice est un groupe irlandais pour l'environnement, la paix et la justice sociale. Gluaiseacht ( prononciation irlandaise: [ˈɡl̪ˠuəʃəxt̪ˠ] ) signifie «mouvement» en irlandais. Le groupe croit en la résistance non violente à la forme actuelle de mondialisation capitaliste. Il s'agissait à l'origine d'un réseau de sociétés écologiques et One World dans les universités et les collèges de toute l'Irlande. Il est membre du Réseau environnemental irlandais. Gluaiseacht a été impliqué dans des manifestations antinucléaires à la base sous-marine Trident à Faslane, en Écosse, et à la centrale nucléaire de Sellafield. Gluaiseacht a organisé le rassemblement Ecotopia 2002 (un camp d'été annuel pour les militants en Europe) en association avec European Youth For Action.
Gluaiseacht Chearta_Sibhialta_na_Gaeltachta/Gluaiseacht Chearta Sibhialta na Gaeltachta :
Gluaiseacht Cearta Sibhialta na Gaeltachta (en anglais : "The Gaeltacht Civil Rights Movement") ou Coiste Cearta Síbialta na Gaeilge (en anglais : Irish Language Civil Rights Committee"), était un groupe de pression faisant campagne pour les droits sociaux, économiques et culturels des locuteurs natifs de Irlandais vivant dans les régions du Gaeltacht. Il a été fondé dans le Connemara en 1969 pour souligner le déclin de la langue irlandaise et pour faire campagne pour plus de droits pour les régions de langue irlandaise dans le domaine de l'accès aux services, à la radiodiffusion et, finalement, à une assemblée élue. a ensuite été nommé Gluaiseacht na Gaeltachta (en anglais: "The Gaeltacht Movement").
Glubb/Glubb :
Glubb est un nom de famille. Les personnes notables portant le nom de famille incluent: Faris Glubb (1939–2004), écrivain, journaliste, traducteur et éditeur anglo-jordanien Frederic Manley Glubb (1857–1938), officier de l'armée britannique John Bagot Glubb (1897–1986), soldat britannique, érudit et auteur
Glubbdubdrib/Glubbdubdrib :
Glubbdubdrib (également orthographié Glubdubdrib ou Glubbdubdribb dans certaines éditions) était une île de sorciers et de magiciens, l'un des pays imaginaires visités par Lemuel Gulliver dans le roman satirique de 1726 Les Voyages de Gulliver de l'auteur anglo-irlandais Jonathan Swift. L'épisode sur Glubbdubdrib "explore le thème de la dégénérescence progressive de l'humanité".
Glubbslyme/Glubbslyme :
Glubbslyme est un roman fantastique de l'auteur pour enfants Jacqueline Wilson.
Glubochek/Glubochek :
Glubochek, en Ukraine, est le site d'une ancienne méga-colonie appartenant à la culture Cucuteni-Trypillia datant de 4000 av. La colonie était pour l'époque très vaste, couvrant une superficie de 132 hectares. Cette proto-ville n'est que l'une des 2 440 colonies de Cucuteni-Trypillia découvertes à ce jour en Moldavie et en Ukraine. 194 (8%) de ces colonies avaient une superficie de plus de 10 hectares entre 5000 et 2700 avant JC et plus de 29 colonies avaient une superficie de l'ordre de 10 à 450 hectares.
Gare ferroviaire de Glubokaya/Gare ferroviaire de Glubokaya :
La gare de Glubokaya (russe : станция Глубокая) est une gare ferroviaire située à Glubokiy, dans le district de Kamensky, dans l'oblast de Rostov, en Russie. Il est à 23 km en aval de Kamenskaya et est situé entre Tarasovka et Pogorelovo sur la ligne Moscou — Rostov-sur-le-Don. Il se trouve à environ 3,5 km de la Federal Automobile Road M-4 "Don".
Glubokovo/Glubokovo :
Glubokovo ( russe : Глубоково ) est une localité rurale (un village) de la colonie urbaine de Mstyora , district de Viaznikovsky , oblast de Vladimir , Russie . La population était de 11 habitants en 2010.
Glubokovo, Petushinsky_District,_Vladimir_Oblast/Glubokovo, Petushinsky District, Vladimir Oblast :
Glubokovo (russe : Глубоково) est une localité rurale (un village) de la colonie rurale de Nagornoye, dans le district de Petushinsky, dans l'oblast de Vladimir, en Russie. La population était de 346 habitants en 2010. Il y a 7 rues.
Glubokovsky/Glubokovsky :
Glubokovsky ( russe : Глубоковский ) est une localité rurale (un khutor ) de la colonie rurale de Kletsko-Pochtovskoye , district de Serafimovichsky , oblast de Volgograd , Russie . La population était de 2 en 2010.
Glubokoye, Altai_Krai/Glubokoye, Altaï Krai :
Glubokoye (russe : Глубокое) est une localité rurale (un selo) et le centre administratif de Glubokovsky Selsoviet, district de Zavyalovsky, kraï de l'Altaï, Russie. La population était de 1 508 habitants en 2013. Il y a 24 rues.
Glubokoye, Totemsky_District,_Vologda_Oblast/Glubokoye, Totemsky District, Vologda Oblast :
Glubokoye ( russe : Глубокое ) est une localité rurale (une colonie) de la colonie rurale de Pyatovskoye , district de Totemsky , oblast de Vologda , Russie . La population était de 187 habitants en 2010. Il y a 3 rues.
Glubokoye, Voronej_Oblast/Glubokoye, Voronej Oblast :
Glubokoye ( russe : Глубокое ) est une localité rurale ( un selo ) de la colonie rurale de Novolimanskoye , district de Petropavlovsky , oblast de Voronej , Russie . La population était de 228 en 2010. Il y a 4 rues.
District de Glubokoye/District de Glubokoye :
Glubokoe ( kazakh : Глубокое ауданы , Glubokoe audany , russe : Глубоковский район ) est un district de la région du Kazakhstan oriental dans l'est du Kazakhstan . Le centre administratif du district est la colonie de Glubokoye ( chinois :格卢博科耶). Population : 63 890 (estimation 2013) ; 63 581 (résultats du recensement de 2009); 67 329 (résultats du recensement de 1999).
Gluboky/Gluboky :
Gluboky (masculin), Glubokaya (féminin) ou Glubokoye (neutre) peut faire référence à : Gluboky, Russie (Glubokaya, Glubokoye), nom de plusieurs localités habitées en Russie Hlybokaye (Glubokoye), une ville de l'oblast de Vitebsk, Biélorussie Glubokoye, un selo et centre administratif du district de Glubokoye , Oblast du Kazakhstan oriental , Kazakhstan Lac Glubokoye (homonymie), plusieurs lacs
Gluboky, Amur_Oblast/Gluboky, Amur Oblast :
Gluboky (russe : Глубокий) est une localité rurale (une station) à Rabochy Posylok Urusha du district de Skovorodinsky, Oblast d'Amour, Russie. La population était de 3 en 2018. Il y a 1 rue.
Gluboky, Kamensky_District,_Rostov_Oblast/Gluboky, Kamensky District, Rostov Oblast :
Gluboky (russe : Глубокий) est une localité urbaine du district de Kamensky dans l'oblast de Rostov, en Russie. Population : 9 880 (recensement de 2010) ; 11 242 (recensement de 2002); 12 198 (recensement de 1989).
Gluboky, Russie/Gluboky, Russie :
Gluboky (russe : Глубокий ; masculin), Glubokaya (Глубокая ; féminin) ou Glubokoye (Глубокое ; neutre) est le nom de plusieurs localités habitées en Russie. Localités urbainesGluboky, district de Kamensky, oblast de Rostov, une colonie de travail dans le district de Kamensky de l'oblast de RostovLocalités ruralesGluboky, oblast d'Amour, une gare ferroviaire sous la juridiction administrative de la colonie urbaine d'Urusha dans le district de Skovorodinsky de l'oblast d'Amour Gluboky (colonie), oblast d'Arkhangelsk, une colonie à Bestuzhevsky Selsoviet du district d'Ustyansky de l'oblast d'Arkhangelsk Gluboky (village), Arkhangelsk Oblast, un village du Bestuzhevsky Selsoviet du district d'Oustyansky de l'oblast d'Arkhangelsk Gluboky, Krasnodar Krai, une colonie de Novoselsky Rural Okrug du district de Novokubansky de Krasnodar Krai Gluboky, district de Zimovnikovsky, Oblast de Rostov, un khutor de l'agglomération rurale de Glubochanskoye du district de Zimovnikovsky de l'oblast de Rostov Gluboky, de l'oblast de Samara, une colonie du district de Sergiyevsky de l'oblast de Samara Gluboky, de l'oblast de Saratov, un khutor du district d'Alexandrovo-Gaysky de l'oblast de Saratov Gluboky, Stavropol Krai, un khutor à Pravokumsky Selsoviet de Sovetsky Distri ct de Stavropol Krai Glubokoye, Altai Krai, un selo à Glubokovsky Selsoviet du district de Zavyalovsky du kraï de l'Altaï Glubokoye, Kemerovo Oblast, un selo dans le territoire rural de Zarubinskaya du district de Topkinsky de l'oblast de Kemerovo Glubokoye, Kurgan Oblast, un selo à Glubokinsky Selsoviet du district de Shadrinsky de l'oblast de Kourgan Glubokoye, district de Luzhsky, oblast de Leningrad, un village de la formation municipale de l'agglomération d'Osminskoye de l'oblast de Luzhsky de l'oblast de Leningrad Glubokoye, formation municipale de l'agglomération de Krasnoselskoye, district de Vyborgsky, oblast de Leningrad, un dépôt forestier de l'agglomération de Krasnoselskoye Formation municipale de l'agglomération du district de Vyborgsky Oblast de Léningrad Glubokoye, formation municipale de l'agglomération de Kamennogorskoye, district de Vyborgsky, oblast de Léningrad, un dépôt d'exploitation forestière dans la formation municipale de l'agglomération de Kamennogorskoye dans le district de Vyborgsky de l'oblast de Léningrad Glubokoye, oblast de Moscou, un selo dans l'agglomération rurale d'Uzunovskoye du district de Serebryano-Prudsky de Moscou Ob dernier Glubokoye, oblast de Novgorod, village de l'agglomération de Gorskoye du district de Soletsky de l'oblast de Novgorod Glubokoye, district d'Opochetsky, oblast de Pskov, village du district d'Opochetsky, oblast de Pskov Glubokoye, district de Sebezhsky, oblast de Pskov, village du district de Sebezhsky, oblast de Pskov Glubokoye , oblast de Smolensk, un village de l'agglomération rurale de Glubokinskoye du district de Krasninsky de l'oblast de Smolensk Glubokoye, de l'oblast de Sverdlovsk, une localité sous la juridiction administrative de la ville d'Ekaterinbourg dans l'oblast de Sverdlovsk Glubokoye, du district de Bologovsky, de l'oblast de Tver, un village de l'agglomération rurale de Kaftinskoye District de Bologovsky de l'oblast de Tver Glubokoye, district de Vyshnevolotsky, oblast de Tver, un village de Dyatlovskoye Village rural du district de Vyshnevolotsky de l'oblast de Tver Glubokoye, district de Zapadnodvinsky, village de l'oblast de Tver, village de Zapadnodvinskoye Village rural du district de Zapadnodvinsky de l'oblast de Tver Glubokoye, un village de l'Okrug rural Berdyuzhsky de Be rdyuzhsky district de l'oblast de Tioumen Glubokoye, Lezhsky Selsoviet, district de Gryazovetsky, oblast de Vologda, un village du Lezhsky Selsoviet du district de Gryazovetsky de l'oblast de Vologda Glubokoye, Vokhtogsky Selsoviet, district de Gryazovetsky, oblast de Vologda, un khutor dans le district de Vokhtogsky Selsoviet de Gryazovetsky de l'oblast de Vologda Glubokoye , district de Totemsky, oblast de Vologda, une colonie de Pyatovsky Selsoviet du district de Totemsky de l'oblast de Vologda Glubokoye, oblast de Voronej, un selo de la colonie rurale de Novolimanskoye du district de Petropavlovsky de l'oblast de Voronej Glubokaya, oblast d'Irkoutsk, une colonie du district de Shelekhovsky de l'oblast d'Irkoutsk Glubokaya, Oblast de Kourgan, un village de Talovsky Selsoviet du district de Yurgamyshsky de l'oblast de Kourgan Glubokaya, oblast de Sverdlovsk, une localité sous la juridiction administrative de la ville de Nizhnyaya Tura dans l'oblast de Sverdlovsk Glubokaya, de l'oblast de Tyumen, un village de l'okrug rural de Lamensky du district de Golyshmanovsky de Tyumen Oblast
Glubothrips/Glubothrips :
Glubothrips est un genre de thrips de la famille des Phlaeothripidae.
Glucagon/Glucagon :
Le glucagon est une hormone peptidique, produite par les cellules alpha du pancréas. Il augmente la concentration de glucose et d'acides gras dans le sang et est considéré comme la principale hormone catabolique du corps. Il est également utilisé comme médicament pour traiter un certain nombre de problèmes de santé. Son effet est opposé à celui de l'insuline, qui abaisse le glucose extracellulaire. Il est produit à partir du proglucagon, codé par le gène GCG. Le pancréas libère du glucagon lorsque la quantité de glucose dans le sang est trop faible. Le glucagon amène le foie à s'engager dans la glycogénolyse : convertir le glycogène stocké en glucose, qui est libéré dans la circulation sanguine. Des niveaux élevés de glucose dans le sang, d'autre part, stimulent la libération d'insuline. L'insuline permet au glucose d'être capté et utilisé par les tissus insulino-dépendants. Ainsi, le glucagon et l'insuline font partie d'un système de rétroaction qui maintient la glycémie stable. Le glucagon augmente la dépense énergétique et est élevé dans des conditions de stress. Le glucagon appartient à la famille des hormones sécrétines.
Glucagon-like peptide-1/Glucagon-like peptide-1 :
Glucagon-like peptide-1 (GLP-1) est une hormone peptidique longue de 30 ou 31 acides aminés dérivant du traitement post-traductionnel spécifique au tissu du peptide proglucagon. Il est produit et sécrété par les cellules L entéroendocrines intestinales et certains neurones du noyau du tractus solitaire du tronc cérébral lors de la consommation d'aliments. Le produit initial GLP-1 (1–37) est sensible à l'amidation et au clivage protéolytique, ce qui donne naissance aux deux formes biologiquement actives tronquées et équipotentes, GLP-1 (7–36) amide et GLP-1 (7–37) . La structure secondaire de la protéine GLP-1 active comprend deux hélices α des positions d'acides aminés 13–20 et 24–35 séparées par une région de liaison. Aux côtés du peptide insulinotrope glucose-dépendant (GIP), le GLP-1 est une incrétine ; ainsi, il a la capacité de diminuer les niveaux de sucre dans le sang d'une manière dépendante du glucose en augmentant la sécrétion d'insuline. Outre les effets insulinotropes, le GLP-1 a été associé à de nombreux effets régulateurs et protecteurs. Contrairement au GIP, l'action du GLP-1 est préservée chez les patients atteints de diabète de type 2 et une importante recherche pharmaceutique s'est donc orientée vers le développement d'un traitement à base de GLP-1. Le GLP-1 endogène est rapidement dégradé principalement par la dipeptidyl peptidase-4 (DPP-4), ainsi que par l'endopeptidase neutre 24.11 (NEP 24.11) et la clairance rénale, ce qui entraîne une demi-vie d'environ 2 minutes. Par conséquent, seuls 10 à 15 % du GLP-1 atteignent la circulation intacte, ce qui conduit à des taux plasmatiques à jeun de seulement 0 à 15 pmol/L. Pour surmonter cela, des agonistes des récepteurs du GLP-1 et des inhibiteurs de la DPP-4 ont été développés pour augmenter l'activité du GLP-1. Contrairement aux agents de traitement courants tels que l'insuline et la sulfonylurée, le traitement à base de GLP-1 a été associé à une perte de poids et à un risque plus faible d'hypoglycémie, deux considérations importantes pour les patients atteints de diabète de type 2.
Récepteur du peptide-1 de type glucagon/récepteur du peptide-1 de type glucagon :
Le récepteur du peptide-1 de type glucagon (GLP1R) est une protéine réceptrice présente sur les cellules bêta du pancréas et sur les neurones du cerveau. Il est impliqué dans le contrôle du taux de sucre dans le sang en augmentant la sécrétion d'insuline. Chez l'homme, il est synthétisé par le gène GLP1R, présent sur le chromosome 6. Il fait partie de la famille des récepteurs du glucagon des récepteurs couplés aux protéines G. Le GLP1R est composé de deux domaines, un domaine extracellulaire (ECD) qui se lie à l'hélice C-terminale du GLP-1 et un domaine transmembranaire (TMD) qui se lie à la région N-terminale du GLP-1. Dans le domaine TMD, il existe un pivot de résidus polaires qui régule la signalisation biaisée du récepteur tandis que les limites hélicoïdales transmembranaires et la surface extracellulaire sont un déclencheur d'agonisme biaisé.
Agoniste_du_récepteur_du_peptide-1 de type glucagon/Agoniste du récepteur du peptide-1 de type glucagon :
Les agonistes des récepteurs du peptide-1 de type glucagon, également appelés agonistes des récepteurs du GLP-1 (GLP-1-RA) ou mimétiques de l'incrétine, sont des agonistes du récepteur du GLP-1. Cette classe de médicaments est utilisée pour le traitement du diabète de type 2. Certains médicaments sont également approuvés pour l'obésité. L'un de leurs avantages par rapport aux anciens sécrétagogues de l'insuline, tels que les sulfonylurées ou les méglitinides, est qu'ils présentent un risque moindre de provoquer une hypoglycémie. Le GLP-1 a une courte durée d'action, donc pour surmonter cette limitation, plusieurs modifications des médicaments ou des formulations sont en cours de développement. Les normes ADA 2022 de soins médicaux pour le diabète incluent le GLP-1-RA comme traitement pharmacologique de première ligne diabète de type 2, en particulier chez les patients atteints de maladies cardiovasculaires athérosclérotiques ou d'obésité.
Glucagon-like peptide-2/Glucagon-like peptide-2 :
Glucagon-like peptide-2 (GLP-2) est un peptide de 33 acides aminés avec la séquence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (voir Acide aminé protéinogène) chez l'homme. Le GLP-2 est créé par clivage protéolytique post-traductionnel spécifique du proglucagon dans un processus qui libère également le peptide-1 apparenté au glucagon (GLP-1). Le GLP-2 est produit par la cellule L endocrinienne intestinale et par divers neurones du système nerveux central. Le GLP-2 intestinal est co-sécrété avec le GLP-1 lors de l'ingestion de nutriments. Lorsqu'il est administré de manière externe, le GLP-2 produit un certain nombre d'effets chez l'homme et les rongeurs, notamment la croissance intestinale, l'amélioration de la fonction intestinale, la réduction de la dégradation osseuse et la neuroprotection. Le GLP-2 peut agir de manière endocrinienne pour lier la croissance et le métabolisme intestinaux à l'apport en nutriments. Le GLP-2 et les analogues apparentés peuvent être des traitements pour le syndrome de l'intestin court, la maladie de Crohn, l'ostéoporose et comme thérapie adjuvante pendant la chimiothérapie anticancéreuse. Le GLP-2 a un effet antidépresseur dans un modèle murin de dépression lorsqu'il est administré par injection intracérébroventriculaire. Cependant, un dérivé du GLP-2 (PAS-CPP-GLP-2) s'est avéré être efficacement délivré au cerveau par voie intranasale, avec une efficacité similaire.
Récepteur du peptide-2 de type glucagon/récepteur du peptide-2 de type glucagon :
Le récepteur du peptide-2 de type glucagon (GLP-2R) est une protéine qui, chez l'homme, est codée par le gène GLP2R situé sur le chromosome 17.
Récepteur de peptides de type glucagon/récepteur de peptides de type glucagon :
Les récepteurs du peptide de type glucagon (GLPR) comprennent les deux récepteurs suivants : Récepteur du peptide de type glucagon 1 (GLP-1R) – lie le peptide de type glucagon 1 (GLP-1) Récepteur du peptide de type glucagon 2 (GLP-2R) – lie le peptide de type glucagon 2 (GLP-2)
Glucagon (médicament)/Glucagon (médicament) :
Le glucagon, vendu entre autres sous le nom de marque Baqsimi, est un médicament et une hormone. En tant que médicament, il est utilisé pour traiter l'hypoglycémie, le surdosage de bêta-bloquants, le surdosage d'inhibiteurs calciques et les personnes souffrant d'anaphylaxie qui ne s'améliorent pas avec l'épinéphrine. Il est administré par injection dans une veine, un muscle ou sous la peau. Une version donnée dans le nez est également disponible. Les effets secondaires courants incluent des vomissements. D'autres effets secondaires comprennent un faible taux de potassium dans le sang et une pression artérielle basse. Il est déconseillé aux personnes atteintes d'un phéochromocytome ou d'un insulinome. L'utilisation pendant la grossesse ne s'est pas avérée nocive pour le bébé. Le glucagon fait partie de la famille des glycogénolytiques. Il agit en provoquant la décomposition du glycogène par le foie en glucose. Le glucagon a été approuvé pour un usage médical aux États-Unis en 1960. Il figure sur la liste des médicaments essentiels de l'Organisation mondiale de la santé. C'est une forme fabriquée de l'hormone glucagon. Une version générique est devenue disponible aux États-Unis en décembre 2020.
Récepteur du glucagon/récepteur du glucagon :
Le récepteur du glucagon est une protéine de 62 kDa qui est activée par le glucagon et fait partie de la famille des récepteurs couplés aux protéines G de classe B, couplés à G alpha i, Gs et dans une moindre mesure G alpha q. La stimulation du récepteur entraîne l'activation de l'adénylate cyclase et de la phospholipase C et une augmentation des niveaux des messagers secondaires AMPc intracellulaire et calcium. Chez l'homme, le récepteur du glucagon est codé par le gène GCGR. Les récepteurs du glucagon sont principalement exprimés dans le foie et les reins avec des quantités moindres dans le cœur, le tissu adipeux, la rate, le thymus, les glandes surrénales, le pancréas, le cortex cérébral et le tractus gastro-intestinal.
Famille des récepteurs du glucagon/famille des récepteurs du glucagon :
La famille des récepteurs du glucagon est un groupe de récepteurs couplés aux protéines G étroitement apparentés qui comprennent : le récepteur du glucagon le récepteur du peptide 1 de type glucagon le récepteur du peptide 2 de type glucagon le récepteur du polypeptide inhibiteur gastriqueLes trois premiers récepteurs se lient à des hormones peptidiques étroitement apparentées (glucagon, glucagon-like peptide-1, peptide-2 de type glucagon) dérivé du polypeptide proglucagon. Le dernier récepteur se lie au polypeptide inhibiteur gastrique.
Sauvetage du glucagon/sauvetage du glucagon :
Glucagon rescue est l'injection d'urgence de glucagon en cas d'hypoglycémie diabétique sévère. Il est nécessaire pendant les crises et/ou l'inconscience d'un utilisateur d'insuline qui est alors incapable de s'aider lui-même. Le glucagon facilitera la libération du glucose stocké dans la circulation sanguine, augmentant ainsi le taux de glucose sanguin. Le sauvetage a été simplifié par le développement du kit de sauvetage de l'hypoglycémie glucagon, composé de : du glucagon humain biosynthétique, sous forme lyophilisée dans un flacon, une seringue robuste, préremplie d'une solution de dilution stérile, et un tube visible de couleur rouge ou orange boîte de rangement en plastique, qui comprend des instructions. Dès les premiers signes d'hypoglycémie, un utilisateur d'insuline doit la traiter immédiatement en consommant des glucides pour rétablir la glycémie à des niveaux sûrs (prévenant ainsi la progression vers une hypoglycémie sévère). Cependant, tous les utilisateurs d'insuline ne peuvent pas ressentir et reconnaître les premiers signes, en particulier lorsqu'ils dorment. Cela peut rapidement conduire à une urgence entraînant une perte de conscience, une incapacité à avaler, des convulsions et, dans les cas extrêmes, la mort. Dans le passé, le traitement consistait en l'administration intraveineuse de dextrose (glucose) généralement dans un service d'urgence hospitalier ; cependant, le retard de traitement dû à l'intervention d'urgence et au transport vers un établissement médical met la vie en danger. Le kit de sauvetage au glucagon permet un sauvetage rapide par une simple injection, qui ne nécessite pas d'expertise médicale, et peut être fait rapidement et facilement en dehors d'un établissement médical.
Glucagonome/Glucagonome :
Le glucagonome est une tumeur très rare des cellules alpha pancréatiques qui entraîne une surproduction de l'hormone glucagon. Généralement associée à une éruption cutanée appelée érythème nécrolytique migrateur, à une perte de poids et à un diabète sucré léger, la plupart des personnes atteintes de glucagonome le contractent spontanément. Cependant, environ 10 % des cas sont associés au syndrome de néoplasie endocrinienne multiple de type 1 (NEM-1).
Glucal/Glucal :
Le glucal est le glycal formé à partir du glucose. C'est un intermédiaire chimique dans la synthèse d'une variété d'oligosaccharides. Glucal et ses dérivés peuvent être convertis en d'autres sucres chimiquement utiles en utilisant le réarrangement de Ferrier.
Glucamétacine/Glucamétacine :
La glucamétacine est un anti-inflammatoire non stéroïdien utilisé pour le traitement des douleurs légères ou modérées associées à la polyarthrite rhumatoïde, à l'arthrose et à d'autres troubles rhumatologiques. Il a des effets analgésiques et anti-inflammatoires. La glucamétacine est un dérivé de l'indométacine contenant de la glucosamine.
Glucane/Glucane :
Un glucane est un polysaccharide dérivé du D-glucose, lié par des liaisons glycosidiques. Les glucanes sont notés sous deux formes : les alpha-glucanes et les bêta-glucanes. De nombreux bêta-glucanes sont médicalement importants. Ils représentent une cible médicamenteuse pour les médicaments antifongiques de la classe des échinocandines.
Glucane 1,3-alpha-glucosidase/Glucane 1,3-alpha-glucosidase :
La glucane 1,3-alpha-glucosidase (EC 3.2.1.84, exo-1,3-alpha-glucanase, glucosidase II, 1,3-alpha-D-glucane 3-glucohydrolase) est une enzyme dont le nom systématique est 3-alpha- D-glucane 3-glucohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse des liaisons terminales (1->3)-alpha-D-glucosidiques dans les (1->3)-alpha-D-glucanesCette enzyme n'agit pas sur le nigéran bien qu'elle ait une certaine activité contre le nigérose.
Glucane 1,3-bêta-glucosidase/Glucane 1,3-bêta-glucosidase :
Glucane 1,3-bêta-glucosidase (EC 3.2.1.58, exo-1,3-bêta-glucosidase, bêta-1,3-glucane exo-hydrolase, exo (1->3)-glucanohydrolase, 1,3-bêta -glucan glucohydrolase) est une enzyme dont le nom systématique est 3-beta-D-glucan glucohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse successive des unités bêta-D-glucose des extrémités non réductrices des (1->3)-bêta-D-glucanes, libérant l'alpha-glucoseAgit sur les oligosaccharides, mais très lentement sur le laminaribiose.
Glucane 1,4-a-glucosidase/Glucane 1,4-a-glucosidase :
Glucane 1,4-α-glucosidase (EC 3.2.1.3, glucoamylase, amyloglucosidase', γ-amylase, α-glucosidase lysosomale, maltase acide, exo-1,4-α-glucosidase, glucose amylase, γ-1,4- glucane glucohydrolase, maltase acide, 1,4-α-D-glucane glucohydrolase) est une enzyme située sur la bordure en brosse de l'intestin grêle avec le nom systématique 4-α-D-glucane glucohydrolase. Il catalyse la réaction chimique suivante Hydrolyse des résidus α-D-glucose terminaux (1 → 4) liés successivement à partir des extrémités non réductrices des chaînes avec libération de β-D-glucose La plupart des formes de l'enzyme peuvent rapidement hydrolyser 1,6- Liaisons α-D-glucosidiques lorsque la liaison suivante dans la séquence est 1,4. Ils appartiennent à une variété de différentes familles de GH, telles que la famille des glycosides hydrolases 15 chez les champignons, la famille des glycosides hydrolases 31 de l'intestin humain MGAM et la famille des glycosides hydrolases 97 des formes bactériennes. Elle était également connue sous le nom de γ-amylase.
Glucane 1,4-alpha-maltohexaosidase/Glucane 1,4-alpha-maltohexaosidase :
La glucane 1,4-alpha-maltohexaosidase (EC 3.2.1.98, exo-maltohexaohydrolase, 1,4-alpha-D-glucane maltohexaohydrolase) est une enzyme portant le nom systématique 4-alpha-D-glucane maltohexaohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse des liaisons (1->4)-alpha-D-glucosidiques dans les polysaccharides amylacés, pour éliminer les résidus successifs de maltohexaose des extrémités de chaîne non réductrices. Les produits ont la configuration alpha.
Glucane 1,4-alpha-maltohydrolase/Glucane 1,4-alpha-maltohydrolase :
La glucane 1,4-alpha-maltohydrolase (EC 3.2.1.133, alpha-amylase maltogénique, 1,4-alpha-D-glucane alpha-maltohydrolase) est une enzyme dont le nom systématique est 4-alpha-D-glucane alpha-maltohydrolase. Cette enzyme catalyse la réaction chimique suivante hydrolyse des liaisons (1->4)-alpha-D-glucosidiques dans les polysaccharides afin d'éliminer les résidus alpha-maltose successifs des extrémités non réductrices des chaînesCette enzyme agit sur l'amidon et les polysaccharides apparentés et oligosaccharides. Amylases maltogéniques de Bacillus stearothermophilus, Thermus sp. et Geobacillus thermoleovorans sont capables de dégrader l'acarbose en glucose et en acarviosine-glucose.
Glucane 1,4-alpha-maltotétrahydrolase/Glucane 1,4-alpha-maltotétrahydrolase :
La glucane 1,4-alpha-maltotétraohydrolase (EC 3.2.1.60, exo-maltotétraohydrolase, 1,4-alpha-D-glucane maltotétraohydrolase) est une enzyme portant le nom systématique 4-alpha-D-glucane maltotétraohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse des liaisons (1->4)-alpha-D-glucosidiques dans les polysaccharides amylacés, pour éliminer les résidus successifs de maltotétraose des extrémités de chaîne non réductrices
Glucane 1,4-alpha-maltotriohydrolase/Glucane 1,4-alpha-maltotriohydrolase :
La glucane 1,4-alpha-maltotriohydrolase (EC 3.2.1.116, exo-maltotriohydrolase, maltotriohydrolase, 1,4-alpha-D-glucan maltotriohydrolase) est une enzyme portant le nom systématique 4-alpha-D-glucan maltotriohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse des liaisons (1->4)-alpha-D-glucosidiques dans les polysaccharides amylacés, pour éliminer les résidus successifs de maltotriose des extrémités de chaîne non réductrices. Les produits ont la configuration alpha.
Glucane 1,4-bêta-glucosidase/Glucane 1,4-bêta-glucosidase :
La glucane 1,4-bêta-glucosidase (ou 4-bêta-D-glucane glucohydrolase) est une enzyme qui catalyse l'hydrolyse des liaisons (1->4) dans les 1,4-bêta-D-glucanes et les oligosaccharides apparentés, en éliminant unités de glucose successives. C'est l'une des cellulases, enzymes impliquées dans l'hydrolyse de la cellulose et des polysaccharides apparentés ; plus précisément, une exocellulase, qui agit en bout de chaîne polysaccharidique. Les autres noms de cette enzyme sont exo-1,4-bêta-glucosidase, exocellulase, exo-bêta-1,4-glucosidase, exo-bêta-1,4-glucanase, bêta-1,4-bêta-glucanase, exo- 1,4-bêta-glucanase et 1,4-bêta-D-glucane glucohydrolase.
Glucane 1,6-a-glucosidase/Glucane 1,6-a-glucosidase :
La glucane 1,6-alpha-glucosidase (EC 3.2.1.70, exo-1,6-bêta-glucosidase, glucodextrinase, glucane alpha-1,6-D-glucohydrolase) est une enzyme avec le nom systématique glucane 6-alpha-D- glucohydrolase. Cette enzyme catalyse la réaction chimique suivante : Hydrolyse des liaisons (1->6)-alpha-D-glucosidiques dans les (1->6)-alpha-D-glucanes et les oligosaccharides dérivés L'hydrolyse s'accompagne d'une inversion en C-1.
Glucane 1,6-alpha-isomaltosidase/Glucane 1,6-alpha-isomaltosidase :
La glucane 1,6-alpha-isomaltosidase (EC 3.2.1.94, exo-isomaltohydrolase, isomalto-dextranase, isomaltodextranase, G2-dextranase, 1,6-alpha-D-glucan isomaltohydrolase) est une enzyme avec le nom systématique 6-alpha-D -glucane isomaltohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse des liaisons (1->6)-alpha-D-glucosidiques dans les polysaccharides, pour éliminer les unités isomaltose successives des extrémités non réductrices des chaînes L'activité optimale se situe sur ces 1,6-alpha-D -glucanes contenant 6, 7 et 8 unités de glucose.
Glucane endo-1,2-bêta-glucosidase/Glucane endo-1,2-bêta-glucosidase :
Glucane endo-1,2-bêta-glucosidase (EC 3.2.1.71, endo-1,2-bêta-glucanase, bêta-D-1,2-glucanase, endo-(1->2)-bêta-D-glucanase , 1,2-bêta-D-glucane glucanohydrolase) est une enzyme dont le nom systématique est 2-bêta-D-glucane glucanohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse aléatoire des liaisons (1->2)-glucosidiques dans les (1->2)-bêta-D-glucanes
Glucane endo-1,3-alpha-glucosidase/Glucane endo-1,3-alpha-glucosidase :
Glucane endo-1,3-alpha-glucosidase (EC 3.2.1.59, endo-1,3-alpha-glucanase, mutanase, endo-(1->3)-alpha-glucanase, cariogénase, cariogénanase, endo-1,3 -alpha-D-glucanase, 1,3(1,3, 1,4)-alpha-D-glucan 3-glucanohydrolase) est une enzyme dont le nom systématique est 3-alpha-D-glucan 3-glucanohydrolase. L'enzyme catalyse la réaction chimique suivante Endohydrolyse des liaisons (1->3)-alpha-D-glucosidiques dans l'isolichenan, le pseudonigeran et le nigeranLes produits du pseudonigeran (1,3-alpha-D-glucane) sont le nigérose et l'alpha-D-glucose.
Glucane endo-1,3-bD-glucosidase/Glucane endo-1,3-bD-glucosidase :
Glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39, endo-1,3-beta-glucanase, laminarinase, laminaranase, oligo-1,3-glucosidase, callase, beta-1,3-glucanase, Kitalase (marque déposée), 1,3-bêta-D-glucane 3-glucanohydrolase, endo-(1,3)-bêta-D-glucanase, (1->3)-bêta-glucane 3-glucanohydrolase, endo-1, 3-bêta-D-glucanase, endo-1,3-bêta-glucosidase, 1,3-bêta-D-glucane glucanohydrolase) est une enzyme dont le nom systématique est 3-bêta-D-glucane glucanohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse des liaisons (1->3)-bêta-D-glucosidiques dans les (1->3)-bêta-D-glucanesCette enzyme est légèrement active sur les liaisons mixtes (1->3,1 ->4)-bêta-D-glucanes.
Glucane endo-1,6-bêta-glucosidase/Glucane endo-1,6-bêta-glucosidase :
Glucan endo-1,6-beta-glucosidase (EC 3.2.1.75, endo-1,6-beta-glucanase, beta-(1->6)-beta-D-glucanase, beta-1,6-glucanase-pustulanase , bêta-1,6-glucane hydrolase, bêta-1,6-glucane 6-glucanohydrolase, 1,6-bêta-D-glucane glucanohydrolase) est une enzyme dont le nom systématique est 6-bêta-D-glucane glucanohydrolase. Cette enzyme catalyse la réaction chimique suivante Hydrolyse aléatoire des liaisons (1->6) dans les (1->6)-bêta-D-glucanesCette enzyme agit sur le lutéin, le pustulan et les 1,6-oligo-bêta-D-glucosides.
Glucanase/Glucanase :
Les glucanases sont des enzymes qui décomposent les gros polysaccharides par hydrolyse. Le produit de la réaction d'hydrolyse est appelé un glucane, un polysaccharide linéaire constitué de jusqu'à 1200 monomères de glucose, maintenus ensemble par des liaisons glycosidiques. Les glucanes sont abondants dans les parois cellulaires de l'endosperme des céréales telles que l'orge, le seigle, le sorgho, le riz et le blé. Les glucanases sont également appelées lichenases, hydrolases, glycosidases, glycosyl hydrolases et/ou laminarinases. De nombreux types de glucanases partagent des séquences d'acides aminés similaires mais des substrats très différents. Parmi les endo-glucanases connues, la 1,3-1,4-β-glucanase est considérée comme la plus active.
Glucane sucrase/Glucane sucrase :
La glucane-sucrase (également connue sous le nom de glucosyltransférase) est une enzyme de la famille des glycosides hydrolases GH70 utilisée par les bactéries lactiques pour séparer le saccharose et utiliser les molécules de glucose résultantes pour construire de longues chaînes de biofilm collantes. Ces homopolysaccharides extracellulaires sont appelés polymères α-glucane. Les enzymes glucane-sucrases peuvent synthétiser une variété de glucanes avec des solubilités, une rhéologie et d'autres propriétés différentes en modifiant le type de liaison glycosidique, le degré de ramification, la longueur, la masse et la conformation des polymères. Les glucane-saccharases sont classées selon la liaison glycosidique qu'elles catalysent. Il peut s'agir de mutansucrases, de dextranesucrases, d'alternansucrases ou de reuteransucrases. Cette polyvalence a rendu la glucane sucrase utile pour les applications industrielles. Le rôle de la glucane-sucrase dans la cariogenèse est un point d'intérêt majeur. Les polymères de glucane collent aux dents dans la bouche humaine et provoquent la carie dentaire.
Glucarate O-hydroxycinnamoyltransférase/Glucarate O-hydroxycinnamoyltransférase :
En enzymologie, une glucarate O-hydroxycinnamoyltransférase (EC 2.3.1.131) est une enzyme qui catalyse la réaction chimique sinapoyl-CoA + glucarate ⇌ {\displaystyle \rightleftharpoons} CoA + O-sinapoylglucarateAinsi, les deux substrats de cette enzyme sont le sinapoyl-CoA et le glucarate, alors que ses deux produits sont le CoA et le O-sinapoylglucarate. Cette enzyme appartient à la famille des transférases, en particulier les acyltransférases transférant des groupes autres que les groupes aminoacyle. Le nom systématique de cette classe d'enzymes est sinapoyl-CoA:glucarate O-(hydroxycinnamoyl)transférase.
Glucarate déshydratase/Glucarate déshydratase :
L'enzyme glucarate déshydratase (EC 4.2.1.40) catalyse la réaction chimique D-glucarate ⇌ {\displaystyle \rightleftharpoons} 5-déhydro-4-désoxy-D-glucarate + H2OCette enzyme appartient à la famille des lyases, en particulier les hydro-lyases , qui clivent les liaisons carbone-oxygène. Le nom systématique de cette classe d'enzymes est D-glucarate hydro-lyase (formant 5-déshydro-4-désoxy-D-glucarate). D'autres noms couramment utilisés incluent la D-glucarate déshydratase et la D-glucarate hydro-lyase. Cette enzyme participe au métabolisme de l'ascorbate et de l'aldarate.
Glucarolactone O-hydroxycinnamoyltransférase/Glucarolactone O-hydroxycinnamoyltransférase :
En enzymologie, une glucarolactone O-hydroxycinnamoyltransférase (EC 2.3.1.132) est une enzyme qui catalyse la réaction chimique. et glucarolactone, alors que ses deux produits sont CoA et O-sinapoylglucarolactone. Cette enzyme appartient à la famille des transférases, en particulier les acyltransférases transférant des groupes autres que les groupes aminoacyle. Le nom systématique de cette classe d'enzymes est sinapoyl-CoA:glucarolactone O-(hydroxycinnamoyl)transférase.
Glucarpidase/Glucarpidase :
La glucarpidase (Voraxaze) est un médicament utilisé pour le traitement des taux élevés de méthotrexate (définis comme 1 micromol/L) pendant le traitement des patients cancéreux qui ont une fonction rénale altérée (et ne peuvent donc pas réduire le médicament à des niveaux sûrs suffisamment après que le médicament a été donné). La glucarpidase est une enzyme qui inactive rapidement le méthotrexate après injection. Étant donné que cet agent réduit les taux systémiques de méthotrexate et pourrait donc interférer avec son efficacité, son utilisation n'est pas recommandée chez les patients dont la fonction rénale est normale ou légèrement altérée ou chez lesquels les taux sériques sont normaux. Le principal antidote pour les surdoses de méthotrexate avant l'approbation de ce médicament était de fortes doses d'acide folinique. Cependant, cet agent n'était pas toujours suffisant pour prévenir l'insuffisance rénale due au méthotrexate. La glucarpidase dégrade également l'acide folinique, de sorte que les deux ne doivent pas être utilisés ensemble (dans les deux heures l'un de l'autre). La glucarpidase, une forme recombinante de l'enzyme bactérienne carboxypeptidase G2 convertit le méthotrexate en glutamate et en acide 2,4-diamino-N(10)-méthylptéroïque. Ceux-ci sont généralement beaucoup moins toxiques et sont en grande partie excrétés par le foie. Une série de cas chez des enfants a révélé que le traitement par méthotrexate à forte dose peut être repris après un cas d'insuffisance rénale aiguë induite par le méthotrexate et traité avec succès par la glucarpidase. mal de tête.
Glucerna/Glucerna :
Glucerna est le nom de marque d'une famille de préparations pour alimentation par sonde, de shakes en bouteille ou en conserve et de barres-collations fabriquées par Abbott Laboratories. Il a été présenté au public en 1989. Ces produits nutritionnels médicaux sont destinés aux personnes atteintes de diabète et sont promus pour leur capacité à satisfaire la faim sans provoquer d'augmentation rapide de la concentration de glucose dans le sang.
Acide Glucique/Acide Glucique :
L'acide glucique est un acide produit par l'action des acides sur le sucre de canne ou des alcalis sur le glucose.
Glucine/Glucine :
La glucine est le nom d'un édulcorant artificiel similaire à la saccharine qui a été utilisé au début du 20e siècle. La substance est un sel de sodium dérivé du goudron de houille. Il est composé d'un mélange d'acides mono- et di-sulfoniques de formule chimique C19H16N4. Il se présente généralement sous la forme d'une poudre brun clair, facilement soluble dans l'eau. Il est insoluble dans l'éther et le chloroforme. La glucine est environ trois cents fois plus sucrée que le sucre de canne. L'utilisation de la glucine comme additif alimentaire est interdite dans la plupart des États-Unis en raison de préoccupations concernant ses effets sur la santé.
Glucitol/Glucitol :
.

Aucun commentaire:

Enregistrer un commentaire

Hummingbird band""

Wikipédia : À propos/Wikipédia : À propos : Wikipédia est une encyclopédie que tout le monde peut modifier, et des dizaines de millions...